PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009106348.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Trihelix
Protein Properties Length: 574aa    MW: 65398.9 Da    PI: 7.7394
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009106348.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix96.32.8e-3043127187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW++ e+laL+++r+em++++r++ lk+plWee+s+km+e g++rs+k+Ckek+en+ k++k++keg+ ++++++  t+++f++lea
  XP_009106348.1  43 RWPRPETLALLKIRSEMDKSFRDSTLKAPLWEEISRKMMELGYKRSAKKCKEKFENVYKYHKRTKEGRTGKSEGK--TYRFFEELEA 127
                     8********************************************************************975544..6******985 PP

2trihelix108.83.5e-34396481187
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqlea 87 
                     rW+k ev aLi++r+++e +++++  k+plWee+s+ mr+ g++rs+k+Ckekwen+nk++kk+ke++kkr + +s+tcpyf+qlea
  XP_009106348.1 396 RWPKTEVEALIRIRKNLEANYQENGTKGPLWEEISAGMRRLGYNRSAKRCKEKWENINKYFKKVKESNKKR-PLDSKTCPYFHQLEA 481
                     8*********************************************************************8.9************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.08940102IPR001005SANT/Myb domain
PfamPF138372.4E-2042127No hitNo description
PROSITE profilePS500907.03942100IPR017877Myb-like domain
CDDcd122034.77E-2442107No hitNo description
SMARTSM007179.2E-4393455IPR001005SANT/Myb domain
CDDcd122031.64E-25395460No hitNo description
Gene3DG3DSA:1.10.10.602.7E-4395452IPR009057Homeodomain-like
PfamPF138377.1E-24395482No hitNo description
PROSITE profilePS500907.491395453IPR017877Myb-like domain
SuperFamilySSF466892.93E-5396489IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 574 aa     Download sequence    Send to blast
MSGNSSGLLD SSGGGVGGLG EEEKDMKMEE TNEVGGGGGG GSRWPRPETL ALLKIRSEMD  60
KSFRDSTLKA PLWEEISRKM MELGYKRSAK KCKEKFENVY KYHKRTKEGR TGKSEGKTYR  120
FFEELEAFES QPAKSPAATT TTTATTSLIP WISSNHPSTE KTPSPLKHQQ HQVSVKPIAT  180
NPTFLAKQPP PTTPFPFYSN NHATTPDHTG FKPTSNDLLN NVSSLNLFSS STSSSTASDE  240
EEDQEKRSRK KRKYWKGLFT KLTKELMEKQ EKMQKKFLET LENRERERIS REEAWKVQEV  300
ARINKEHETL VHERSNAAAK DAAIISFLHK ISGGGGQQQQ QQQPQQQPQQ NQKLPQRKQY  360
QSEQHSITFE SKEPMPVPLD ATMKMGNHSL SPSSSRWPKT EVEALIRIRK NLEANYQENG  420
TKGPLWEEIS AGMRRLGYNR SAKRCKEKWE NINKYFKKVK ESNKKRPLDS KTCPYFHQLE  480
ALYNERNKNG ALPMLPLMVT PQRQLLLPQE TQTEFETDGR DKVGNKEGEE EGESEEDDYE  540
DEDEEGEGDN DTSEFEIVLN KTSSPMDINN NLFT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18593KRSAKKCKE
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.315741e-160bud
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00244DAPTransfer from AT1G76890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009106348.10.0PREDICTED: trihelix transcription factor GT-2-like
SwissprotQ391170.0TGT2_ARATH; Trihelix transcription factor GT-2
TrEMBLM4DGT90.0M4DGT9_BRARP; Uncharacterized protein
STRINGBra015715.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59952847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.20.0Trihelix family protein